Protein Info for ECD_00886 in Escherichia coli BL21

Annotation: regulatory protein for ClpA substrate specificity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF02617: ClpS" amino acids 23 to 102 (80 residues), 122.1 bits, see alignment E=3.4e-40

Best Hits

Swiss-Prot: 100% identical to CLPS_ECOLC: ATP-dependent Clp protease adapter protein ClpS (clpS) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K06891, ATP-dependent Clp protease adaptor protein ClpS (inferred from 100% identity to eco:b0881)

Predicted SEED Role

"ATP-dependent Clp protease adaptor protein ClpS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>ECD_00886 regulatory protein for ClpA substrate specificity (Escherichia coli BL21)
MGKTNDWLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQ
LMLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHPLLCTLEKA