Protein Info for ECD_00812 in Escherichia coli BL21

Annotation: putative drug efflux MFS transporter, inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details PF07690: MFS_1" amino acids 143 to 334 (192 residues), 48.2 bits, see alignment E=3.8e-17 amino acids 223 to 396 (174 residues), 69.4 bits, see alignment E=1.4e-23

Best Hits

Swiss-Prot: 100% identical to YBJJ_ECOLI: Inner membrane protein YbjJ (ybjJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0845)

Predicted SEED Role

"Putative transport protein/putative regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>ECD_00812 putative drug efflux MFS transporter, inner membrane protein (Escherichia coli BL21)
MTVNSSRNALKRRTWALFMFFFLPGLLMASWATRTPAIRDILSVSIAEMGGVLFGLSIGS
MSGILCSAWLVKRFGTRNVILVTMSCALIGMMILSLALWLTSPLLFAVGLGVFGASFGSA
EVAINVEGAAVEREMNKTVLPMMHGFYSLGTLAGAGVGMALTAFGVPATVHILLAALVGI
APIYIAIQAIPDGTGKNAADGTQHGEKGVPFYRDIQLLLIGVVVLAMAFAEGSANDWLPL
LMVDGHGFSPTSGSLIYAGFTLGMTVGRFTGGWFIDRYSRVAVVRASALMGALGIGLIIF
VDSAWVAGVSVVLWGLGASLGFPLTISAASDTGPDAPTRVSVVATTGYLAFLVGPPLLGY
LGEHYGLRSAMLVVLALVILAAIVAKAVAKPDTKTQTAMENS