Protein Info for ECD_00804 in Escherichia coli BL21

Annotation: soluble aldose sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07995: GSDH" amino acids 34 to 366 (333 residues), 449.3 bits, see alignment E=4.8e-139

Best Hits

Swiss-Prot: 100% identical to YLII_ECOLI: Aldose sugar dehydrogenase YliI (yliI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0837)

MetaCyc: 100% identical to aldose sugar dehydrogenase YliI (Escherichia coli K-12 substr. MG1655)
1.1.5.-

Predicted SEED Role

"Soluble aldose sugar dehydrogenase, PQQ-dependent (EC 1.1.5.-)" (EC 1.1.5.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>ECD_00804 soluble aldose sugar dehydrogenase (Escherichia coli BL21)
MHRQFFFLVPLICLSSALWAASATVNVEVLQDKLDHPWALAFLPDNHGMLITLRGGELRH
WQAGKGLSAPLSGVPDVWAHGQGGLLDVVLAPDFAQSRRIWLSYSEVGDDGKAGTAVGYG
RLSDDLSKVTDFRTVFRQMPKLSTGNHFGGRLVFDGKGYLFIALGENNQRPTAQDLDKLQ
GKLVRLTDQGEIPDDNPFIKESGARAEIWSYGIRNPQGMAMNPWSNALWLNEHGPRGGDE
INIPQKGKNYGWPLATWGINYSGFKIPEAKGEIVAGTEQPVFYWKDSPAVSGMAFYNSDK
FPQWQQKLFIGALKDKDVIVMSVNGDKVTEDGRILTDRGQRIRDVRTGPDGYLYVLTDES
SGELLKVSPRN