Protein Info for ECD_00698 in Escherichia coli BL21

Annotation: membrane spanning protein in TolA-TolQ-TolR complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details PF02472: ExbD" amino acids 10 to 141 (132 residues), 78 bits, see alignment E=3.5e-26 TIGR02801: protein TolR" amino acids 13 to 140 (128 residues), 133.8 bits, see alignment E=2.8e-43

Best Hits

Swiss-Prot: 99% identical to TOLR_SHIFL: Tol-Pal system protein TolR (tolR) from Shigella flexneri

KEGG orthology group: K03560, biopolymer transport protein TolR (inferred from 99% identity to eco:b0738)

Predicted SEED Role

"Tol biopolymer transport system, TolR protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>ECD_00698 membrane spanning protein in TolA-TolQ-TolR complex (Escherichia coli BL21)
MARARGRGRRDLKSEINIVPLLDVLLVLLLIFMATAPIITQSVEVDLPDATESQAVSSND
NPPVIVEVSGIGQYTVVVKKDRLERLPPEQVVAEVSSRFKANPKTVFLIGGAKDVPYDEI
IKALNLLHSAGVKSVGLMTQPI