Protein Info for ECD_00452 in Escherichia coli BL21

Annotation: putative DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 PF13384: HTH_23" amino acids 10 to 53 (44 residues), 25 bits, see alignment E=1.9e-09 PF13551: HTH_29" amino acids 11 to 74 (64 residues), 72.3 bits, see alignment E=4.3e-24 PF13518: HTH_28" amino acids 12 to 60 (49 residues), 26.3 bits, see alignment E=9.5e-10

Best Hits

Swiss-Prot: 100% identical to YLBG_ECO57: Uncharacterized protein YlbG (ylbG) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to sbo:SBO_0404)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (123 amino acids)

>ECD_00452 putative DNA-binding transcriptional regulator (Escherichia coli BL21)
MLHTANPVIKHKAGLLNLAEELSNVSKACKIMGVSRDTFYRYRELVAEGGVDAQINRSRR
APNLKNRTDEATEQAVVDYAVAFPTHGQHRASNELRKQGVFISDSGVRSVWLLHNLENLK
RRY