Protein Info for ECD_00427 in Escherichia coli BL21

Annotation: acetyl esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF10340: Say1_Mug180
  • amino acids 78 to 235 (158 residues), 30.1 bits, E=3.6e-11
• PF20434: BD-FAE
  • amino acids 86 to 184 (99 residues), 61.2 bits, E=1.6e-20
• PF07859: Abhydrolase_3
  • amino acids 87 to 295 (209 residues), 196.8 bits, E=6e-62

Best Hits

Swiss-Prot: 99% identical to AES_ECOHS: Acetyl esterase (aes) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: None (inferred from 100% identity to ebd:ECBD_3180)

MetaCyc: 99% identical to acetylesterase (Escherichia coli K-12 substr. MG1655)
Acetylesterase. [EC: 3.1.1.6]

Predicted SEED Role

"Acetyl esterase (EC 3.1.1.-)" (EC 3.1.1.-)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Alkaloid biosynthesis II
• Ascorbate and aldarate metabolism
• Glycerophospholipid metabolism
• Retinol metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.- or 3.1.1.6

Protein Sequence (319 amino acids)

>ECD_00427 acetyl esterase (Escherichia coli BL21)
MKPENKLPVLDLISAGMKTVVNTLQPDLPPWPATGTIAEQRQYYTLERRFWNAGAPEMAT
RAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIG
IDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRD
KQIDCGKIAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYY
CLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHTFLHYSRM
MKTADEALRDGAQFFTAQL