Protein Info for ECD_00406 in Escherichia coli BL21

Annotation: excision repair protein, alkyltransferase-like protein ATL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 32 to 102 (71 residues), 52.8 bits, see alignment E=1.6e-18 PF01035: DNA_binding_1" amino acids 33 to 112 (80 residues), 93.8 bits, see alignment E=2.4e-31

Best Hits

Swiss-Prot: 100% identical to ATL_SHIFL: DNA base-flipping protein (atl) from Shigella flexneri

KEGG orthology group: K07443, methylated-DNA-protein-cysteine methyltransferase related protein (inferred from 100% identity to eco:b0454)

Predicted SEED Role

"methylated-DNA--protein-cysteine methyltransferase-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>ECD_00406 excision repair protein, alkyltransferase-like protein ATL (Escherichia coli BL21)
MLVSCAMRLHSGVFPDYAEKLPQEEKMEKEDSFPQRVWQIVAAIPEGYVTTYGDVAKLAG
SPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQRQALLAEGVMVSGSGQI
DLQRYRWNY