Protein Info for ECD_00366 in Escherichia coli BL21

Annotation: phosphatidylglycerophosphatase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 21 to 51 (31 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details PF04608: PgpA" amino acids 24 to 161 (138 residues), 149.5 bits, see alignment E=3.1e-48

Best Hits

Swiss-Prot: 100% identical to PGPA_ECOLI: Phosphatidylglycerophosphatase A (pgpA) from Escherichia coli (strain K12)

KEGG orthology group: K01095, phosphatidylglycerophosphatase A [EC: 3.1.3.27] (inferred from 100% identity to eco:b0418)

MetaCyc: 100% identical to phosphatidylglycerophosphatase A (Escherichia coli K-12 substr. MG1655)
Phosphatidylglycerophosphatase. [EC: 3.1.3.27]

Predicted SEED Role

"Phosphatidylglycerophosphatase A (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.27

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (172 amino acids)

>ECD_00366 phosphatidylglycerophosphatase A (Escherichia coli BL21)
MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAAIPFWYLMTFLPWQLY
SLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMALPTNDWQWVAAGFVIF
RILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIGHHWPLGILS