Protein Info for ECD_00348 in Escherichia coli BL21

Annotation: sensory histidine kinase in two-component regulatory system with PhoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 35 to 59 (25 residues), see Phobius details PF11808: PhoR" amino acids 6 to 91 (86 residues), 94.6 bits, see alignment E=1.2e-30 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 95 to 421 (327 residues), 460.4 bits, see alignment E=3.1e-142 PF00989: PAS" amino acids 99 to 194 (96 residues), 46.6 bits, see alignment E=9.4e-16 PF13188: PAS_8" amino acids 99 to 150 (52 residues), 22.7 bits, see alignment 2.2e-08 PF00512: HisKA" amino acids 203 to 268 (66 residues), 73.3 bits, see alignment E=4.1e-24 PF02518: HATPase_c" amino acids 313 to 424 (112 residues), 102.7 bits, see alignment E=4.8e-33 PF13581: HATPase_c_2" amino acids 317 to 405 (89 residues), 27.8 bits, see alignment E=6.9e-10

Best Hits

Swiss-Prot: 99% identical to PHOR_ECOLI: Phosphate regulon sensor protein PhoR (phoR) from Escherichia coli (strain K12)

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 99% identity to eco:b0400)

MetaCyc: 99% identical to sensor histidine kinase PhoR (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>ECD_00348 sensory histidine kinase in two-component regulatory system with PhoB (Escherichia coli BL21)
MLERLSWKRLVLELLLCCFPAFILGAFFGYLPWFLLASVTGLLIWHFWNLLRLSWWLWVD
RSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGAESLPDAVVLTTEEGGI
FWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSRPLNLVLNTGRHLEIRVM
PYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVLQGYLEMMDEQPLEGAVRE
KALHTMREQTQRMEGLVKQLLTLSKIEAAPTQLLNEKVDVPMMLRVVEREAQTLSQKKQT
FTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHITVRWLRVPHGAEFSVEDNGPG
IAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVNHHESRLNIESTVGKGTRFSFV
IPERLIAKNSD