Protein Info for ECD_00312 in Escherichia coli BL21

Annotation: outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR04390: outer membrane protein, YaiO family" amino acids 22 to 257 (236 residues), 184.1 bits, see alignment E=2e-58 PF19413: YaiO" amino acids 23 to 201 (179 residues), 97 bits, see alignment E=6.7e-32

Best Hits

Swiss-Prot: 99% identical to YAIO_ECOLI: Outer membrane protein YaiO (yaiO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b0358)

Predicted SEED Role

"Putative uncharacterized protein YaiO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>ECD_00312 outer membrane protein (Escherichia coli BL21)
MIKRTLLAAAIFSALPAYAGLTSITAGYDFTDYSGDHGNRNLAYAELVAKVENATLLFNL
SQGRRDYETEHFNATRGQGAVWYKWNNWLTTRTGIAFADNTPVFARQDFRQDINLALLPK
TLFTTGYRYTKYYDDVEVDAWQGGVSLYTGPVITSYRYTHYDSSDAGGSYSNMISVRLND
PRGTGYTQLWLSRGTGAYTYDWTPETRYGSMKSVSLQRIQPLTEQLNLGLTAGKVWYDTP
TDDYNGLQLAAHLTWKF