Protein Info for ECD_00220 in Escherichia coli BL21

Annotation: mRNA interferase toxin of toxin-antitoxin pair YafQ/DinJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 transmembrane" amino acids 30 to 47 (18 residues), see Phobius details TIGR00053: addiction module toxin component, YafQ family" amino acids 4 to 91 (88 residues), 117.8 bits, see alignment E=2.6e-38 PF15738: YafQ_toxin" amino acids 5 to 92 (88 residues), 107.7 bits, see alignment E=1.6e-35 TIGR02385: addiction module toxin, RelE/StbE family" amino acids 6 to 91 (86 residues), 90.2 bits, see alignment E=9.4e-30

Best Hits

Swiss-Prot: 100% identical to YAFQ_ECOBD: mRNA interferase toxin YafQ (yafQ) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: None (inferred from 98% identity to eco:b0225)

MetaCyc: 98% identical to ribosome-dependent mRNA interferase toxin YafQ (Escherichia coli K-12 substr. MG1655)
3.1.26.-

Predicted SEED Role

"YafQ toxin protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (92 amino acids)

>ECD_00220 mRNA interferase toxin of toxin-antitoxin pair YafQ/DinJ (Escherichia coli BL21)
MIQRDIEYSGQFSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPAVYKDHPLQSSWKGYR
DAHVEPDWILIYKLTDKLLRFERTGTHAALFG