Protein Info for ECD_00208 in Escherichia coli BL21

Annotation: DNA polymerase III epsilon subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family" amino acids 6 to 225 (220 residues), 331.2 bits, see alignment E=2.6e-103 TIGR01406: DNA polymerase III, epsilon subunit" amino acids 7 to 242 (236 residues), 318.2 bits, see alignment E=3.3e-99 PF00929: RNase_T" amino acids 9 to 175 (167 residues), 152.5 bits, see alignment E=7.9e-49

Best Hits

Swiss-Prot: 99% identical to DPO3E_ECOLI: DNA polymerase III subunit epsilon (dnaQ) from Escherichia coli (strain K12)

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 99% identity to eco:b0215)

MetaCyc: 99% identical to DNA polymerase III subunit epsilon (Escherichia coli K-12 substr. MG1655)
3.1.11.-

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>ECD_00208 DNA polymerase III epsilon subunit (Escherichia coli BL21)
MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDP
EAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPK
TNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
GQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDDELAAHEARLDLVQKKGGSCL
WRA