Protein Info for ECD_00152 in Escherichia coli BL21

Annotation: iron(3+)-hydroxamate import ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 59 to 79 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 249 to 265 (17 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details amino acids 480 to 499 (20 residues), see Phobius details amino acids 525 to 542 (18 residues), see Phobius details amino acids 544 to 545 (2 residues), see Phobius details amino acids 567 to 594 (28 residues), see Phobius details amino acids 606 to 626 (21 residues), see Phobius details amino acids 631 to 655 (25 residues), see Phobius details PF01032: FecCD" amino acids 17 to 323 (307 residues), 209 bits, see alignment E=4.6e-66 amino acids 358 to 657 (300 residues), 247.5 bits, see alignment E=8.5e-78

Best Hits

Swiss-Prot: 100% identical to FHUB_ECOLI: Iron(3+)-hydroxamate import system permease protein FhuB (fhuB) from Escherichia coli (strain K12)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to eco:b0153)

MetaCyc: 100% identical to iron(III) hydroxamate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-11-RXN [EC: 7.2.2.16]; TRANS-RXN-297 [EC: 7.2.2.16]; TRANS-RXN-298 [EC: 7.2.2.16]

Predicted SEED Role

"Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), permease component FhuB" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin (TC 3.A.1.14.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (660 amino acids)

>ECD_00152 iron(3+)-hydroxamate import ABC transporter permease (Escherichia coli BL21)
MSKRIALFPALLLALLVIVATALTWMNFSQALPRSQWAQAAWSPDIDVIEQMIFHYSLLP
RLAISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGVATGAQLGITVTTLWAIPGAMASQFA
ALVGACVVGLIVFGVAWGKRLSPVTLILAGLVVSLYCGAINQLLVIFHHDQLQSMFLWST
GTLTQTDWGGVERLWPQLLGGVMLTLLLLRPLTLMGLDDGVARNLGLALSLARLAALSLA
IVISALLVNAVGIIGFIGLFAPLLAKMLGARRLLPRLMLASLIGALILWLSDQIILWLTR
VWMEVSTGSVTALIGAPLLLWLLPRLRSISAPDMKVNDRVAAERQHVLAFALAGGVLLLM
AVVVALSFGRDAHGWTWASGALLEDLMPWRWPRIMAALFAGVMLAVAGCIIQRLTGNPMA
SPEVLGISSGAAFGVVLMLFLVPGNAFGWLLPAGSLGAAVTLLIIMIAAGRGGFSPHRML
LAGMALSTAFTMLLMMLQASGDPRMAQVLTWISGSTYNATDAQVWRTGIVMVILLAITPL
CRRWLTILPLGGDTARAVGMALTPTRIALLLLAACLTATATMTIGPLSFVGLMAPHIARI
MGFRRTMPHIVISALVGGLLLVFADWCGRMVLFPFQIPAGLLSTFIGAPYFIYLLRKQSR