Protein Info for ECD_00128 in Escherichia coli BL21

Annotation: putative PTS Enzyme IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF03610: EIIA-man" amino acids 3 to 116 (114 residues), 105.9 bits, see alignment E=6.9e-35

Best Hits

Swiss-Prot: 99% identical to YADI_ECOLI: Putative phosphotransferase enzyme IIA component YadI (yadI) from Escherichia coli (strain K12)

KEGG orthology group: K02821, PTS system, ascorbate-specific IIA component [EC: 2.7.1.69] (inferred from 99% identity to eco:b0129)

MetaCyc: 99% identical to putative PTS enzyme IIA component YadI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Putative PTS system IIA component yadI (EC 2.7.1.69)" (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>ECD_00128 putative PTS Enzyme IIA (Escherichia coli BL21)
MLGWVITCHDDRAQEMLDALEKKHGALLQCRAVNFWRGLSSNMLSRMMCDALHEADSGEG
VIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACRETMTSSEFRERIVELG
APEVSSLWHQQQKNPPFVLKHNLYEY