Protein Info for ECD_00091 in Escherichia coli BL21

Annotation: N-acetylglucosaminyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 3 to 347 (345 residues), 377.2 bits, see alignment E=3.6e-117 PF03033: Glyco_transf_28" amino acids 9 to 145 (137 residues), 168.3 bits, see alignment E=2e-53 PF13439: Glyco_transf_4" amino acids 25 to 145 (121 residues), 31 bits, see alignment E=5e-11 PF04101: Glyco_tran_28_C" amino acids 185 to 344 (160 residues), 133 bits, see alignment E=2.2e-42

Best Hits

Swiss-Prot: 100% identical to MURG_ECOBW: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 100% identity to eco:b0090)

MetaCyc: 100% identical to N-acetylglucosaminyl transferase (Escherichia coli K-12 substr. MG1655)
acetylglucosaminyltransferase. [EC: 2.4.1.227]

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>ECD_00091 N-acetylglucosaminyl transferase (Escherichia coli BL21)
MSGQGKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRMEADLVPKHGIEIDFI
RISGLRGKGIKALIAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIP
VVLHEQNGIAGLTNKWLAKIATKVMQAFPGAFPNAEVVGNPVRTDVLALPLPQQRLAGRE
GPVRVLVVGGSQGARILNQTMPQVAAKLGDSVTIWHQSGKGSQQSVEQAYAEAGQPQHKV
TEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPFQHKDRQQYWNALPLEKAGA
AKIIEQPQLSVDAVANTLAGWSRETLLTMAERARAASIPDATERVANEVSRVARA