Protein Info for ECD_00069 in Escherichia coli BL21

Annotation: thiamine/thiamine pyrophosphate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 331 to 354 (24 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details amino acids 465 to 484 (20 residues), see Phobius details amino acids 507 to 525 (19 residues), see Phobius details TIGR01253: thiamine/thiamine pyrophosphate ABC transporter, permease protein" amino acids 8 to 525 (518 residues), 994.8 bits, see alignment E=5.6e-304 PF00528: BPD_transp_1" amino acids 74 to 267 (194 residues), 36 bits, see alignment E=3e-13 amino acids 372 to 523 (152 residues), 29.3 bits, see alignment E=3.5e-11

Best Hits

Swiss-Prot: 99% identical to THIP_ECOLI: Thiamine transport system permease protein ThiP (thiP) from Escherichia coli (strain K12)

KEGG orthology group: K02063, thiamine transport system permease protein (inferred from 100% identity to ebr:ECB_00069)

MetaCyc: 99% identical to thiamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (536 amino acids)

>ECD_00069 thiamine/thiamine pyrophosphate ABC transporter permease (Escherichia coli BL21)
MATRRQPLIPGWLIPGVSATTLVVAVALAAFLALWWNAPQDDWVAVWQDSYLWHVVRFSF
WQAFLSALLSVVPAIFLARALYRRRFPGRLALLRLCAMTLILPVLVAVFGILSVYGRQGW
LATLCQSLGLEWTFSPYGLQGILLAHVFFNLPMASRLLLQALENIPGEQRQLAAQLGMRG
WHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQATTIELAIYQALSYDYDP
ARAAMLALIQMVCCLGLVLLSQRLSKAIAPGTTLLQGWRDPDDRLHSRICDTVLIVLALL
LLLPPLLAVIVDGLNRQLPEVLAQPVLWQALWTSLRIALAAGVLCVVLTMMLLWSSRELR
ARQKMLAGQALEMSGMLILAMPGIVLATGFFLLLNNTIGLPQSADGIVIFTNALMAIPYA
LKVLENPMRDITARYSMLCQSLGIEGWSRLKVVELRALKRPLAQALAFACVLSIGDFGVV
ALFGNDDFRTLPFYLYQQIGSYRSQDGAVTALILLLLCFLLFTVIEKLPGRDVKTD