Protein Info for ECD_00066 in Escherichia coli BL21

Annotation: ara regulon transcriptional activator; autorepressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF02311: AraC_binding" amino acids 22 to 160 (139 residues), 93.9 bits, see alignment E=1e-30 PF00165: HTH_AraC" amino acids 190 to 227 (38 residues), 34.1 bits, see alignment 3.4e-12 amino acids 240 to 277 (38 residues), 35.1 bits, see alignment 1.6e-12 PF12833: HTH_18" amino acids 200 to 278 (79 residues), 79.2 bits, see alignment E=3.6e-26

Best Hits

Swiss-Prot: 100% identical to ARAC_ECOLI: Arabinose operon regulatory protein (araC) from Escherichia coli (strain K12)

KEGG orthology group: K02099, AraC family transcriptional regulator, arabinose operon regulatory protein (inferred from 100% identity to eco:b0064)

Predicted SEED Role

"Arabinose operon regulatory protein" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>ECD_00066 ara regulon transcriptional activator; autorepressor (Escherichia coli BL21)
MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGYILNLTIRGQGVVKNQ
GREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYWHEWLNWPSIFANTGFF
RPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRRMEAINESLHPPMDNRVR
EACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLS
TTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCEEKVNDVAVKLS