Protein Info for ECD_00040 in Escherichia coli BL21
Annotation: carnitinyl-CoA dehydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CAID_ECOLC: Carnitinyl-CoA dehydratase (caiD) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
KEGG orthology group: K08299, carnitinyl-CoA dehydratase [EC: 4.2.1.-] (inferred from 99% identity to sdy:SDY_0058)MetaCyc: 100% identical to crotonobetainyl-CoA hydratase (Escherichia coli K-12 substr. MG1655)
CARNDETRU-RXN [EC: 4.2.1.149]
Predicted SEED Role
"Carnitine racemase (EC 5.-.-.-) / Carnitinyl-CoA dehydratase (EC 4.2.1.-)" (EC 4.2.1.-, EC 5.-.-.-)
MetaCyc Pathways
- L-carnitine degradation I (4/5 steps found)
- γ-butyrobetaine degradation III (1/4 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Fatty acid biosynthesis
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Nucleotide sugars metabolism
- Pentose and glucuronate interconversions
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Porphyrin and chlorophyll metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.-, 5.-.-.-
Use Curated BLAST to search for 4.2.1.- or 4.2.1.149 or 5.-.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (297 amino acids)
>ECD_00040 carnitinyl-CoA dehydratase (Escherichia coli BL21) MKRQGTTLPANNHALKQYAFFAGMLSSLKKQKWRKGMSESLHLTRNGSILEITLDRPKAN AIDAKTSFEMGEVFLNFRDDPQLRVAIITGAGEKFFSAGWDLKAAAEGEAPDADFGPGGF AGLTEIFNLDKPVIAAVNGYAFGGGFELALAADFIVCADNASFALPEAKLGIVPDSGGVL RLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELMDNARELAQQLVNSAPLAI AALKEIYRTTSEMPVEEAYRYIRSGVLKHYPSVLHSEDAIEGPLAFAEKRDPVWKGR