Protein Info for DZA65_RS22735 in Dickeya dianthicola ME23

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details amino acids 29 to 33 (5 residues), see Phobius details transmembrane" amino acids 20 to 28 (9 residues), see Phobius details amino acids 34 to 43 (10 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 146 to 163 (18 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 205 to 233 (29 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 356 to 393 (38 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XV32 at UniProt or InterPro

Protein Sequence (405 amino acids)

>DZA65_RS22735 hypothetical protein (Dickeya dianthicola ME23)
MKMIELSQRNMQVLMLKTFLSICVLLPTGSVWGVNVKFLFLFLLLGATLLDKGRGVVKII
IGLLPAVTLILIFSLITEFNGRYTLVSVEQTKDLLVFFLMVTLGYALVKPENRYEVIVKT
IIRCLVVLGLFKILIFFYAALSGRGVSFIVQGISTFFNTSLMTMESDDVVVSRINFMSDY
LIPAALYLSLREVLIKKTLWKEWGVIFILFSSLIISMSRFLWAAGFLCLFLALISNYKKY
KSFFIICVMVSLAVFLLSLPSVQDLIEFRFLSKGVTESDLTRTLQYNGIVKHFIEYPLLG
NGIGYYIPDLIRSHLSLYSYELQIPALYMQMGIIGASSIILIVLTILFSQMKGLSLNLSI
SYIVLIALWLSGGFFNPVIISSTGGVSFLLIYSMPNALKYQGEAT