Protein Info for DZA65_RS22700 in Dickeya dianthicola ME23

Annotation: membrane protein insertase YidC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 345 to 369 (25 residues), see Phobius details amino acids 415 to 437 (23 residues), see Phobius details amino acids 460 to 478 (19 residues), see Phobius details amino acids 492 to 516 (25 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 3 to 349 (347 residues), 386.6 bits, see alignment E=1.7e-119 PF14849: YidC_periplas" amino acids 60 to 340 (281 residues), 302.1 bits, see alignment E=6e-94 PF02096: 60KD_IMP" amino acids 343 to 532 (190 residues), 264.4 bits, see alignment E=6e-83 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 350 to 530 (181 residues), 228.2 bits, see alignment E=9e-72

Best Hits

Swiss-Prot: 88% identical to YIDC_PECCP: Membrane protein insertase YidC (yidC) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 98% identity to ddd:Dda3937_01063)

MetaCyc: 79% identical to membrane protein insertase YidC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-403

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3E7 at UniProt or InterPro

Protein Sequence (543 amino acids)

>DZA65_RS22700 membrane protein insertase YidC (Dickeya dianthicola ME23)
MDSQRNLLLIALLFVTFMIWQQWETDKNPPAATQTTQQANGAVGDAANQGVPASGTGKLI
TVKTDVLSLNINTRGGDIEEADLLTYPAELGSSQPFKLLETTPAFTYQAQSGLTGKNGPD
NPANGSRPLYTAPADRFELAAGQNELRIPLTYTDASGVSFTKTFVLKRGEYALNVEYAVN
NTSAQQLELSLFGQLKQSIDLPSHRDTGSNNFALHTYRGAAFSSSDDKYRKYSFSDMKEN
LNITTQGGWVAMLQQYFATAWVPAAAGSNTFYSTNLGNGLAAIGFKATPVMVQPGSQQNL
NATLWVGPEIQDKMATVAPHLDLTVDYGWLWFISQPLFKLLKFLHGFIGNWGFSIIAITF
IVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDKQRMSQEMMALYKAEKVNPLGGC
FPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQDPYYVLPILMGLTMFFIQKMSP
TTVTDPMQQKIMTYMPVIFTVFFLWFPSGLVLYYIVSNLVTIAQQQLIYRGLEKRGLHSR
EKK