Protein Info for DZA65_RS22685 in Dickeya dianthicola ME23

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF00106: adh_short" amino acids 6 to 194 (189 residues), 162.6 bits, see alignment E=2e-51 PF08659: KR" amino acids 8 to 169 (162 residues), 47 bits, see alignment E=7.5e-16 PF01370: Epimerase" amino acids 8 to 170 (163 residues), 30.7 bits, see alignment E=5.3e-11 PF13561: adh_short_C2" amino acids 14 to 198 (185 residues), 115.8 bits, see alignment E=6.2e-37 PF08643: DUF1776" amino acids 95 to 189 (95 residues), 25.2 bits, see alignment E=2.6e-09

Best Hits

KEGG orthology group: None (inferred from 41% identity to cpi:Cpin_0085)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y5Z9 at UniProt or InterPro

Protein Sequence (293 amino acids)

>DZA65_RS22685 SDR family oxidoreductase (Dickeya dianthicola ME23)
MSDTKKSVVITGSSSGFGKKSVKDFADKGYQVFATMRAPEGKNATVKAELEAYSDFIHVV
DMDVTNDESVKTAIASVLNKAGKIDILINNAGVMYLGITEAFSISQAREQMETNYYGAMR
TIQAVLPAMRDAKSGLIINTSSMVGQISAPYFSTYAATKHALEGYLQGLRYEVAPFGIDI
AIVQPGPFPTGLSAAGQEPAHKDILDSYGELAKIPSAMFEEFGKFMQSDQAPDPQMVVDT
YLALADMPTGKRPTRTAVGLVWGVDEINAAKQPIQDRVLKEMQLDNVLGGADA