Protein Info for DZA65_RS22635 in Dickeya dianthicola ME23
Annotation: 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 63% identical to ARNE_ERWT9: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
KEGG orthology group: K12962, undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnE (inferred from 96% identity to ddd:Dda3937_01075)MetaCyc: 50% identical to undecaprenyl-phosphate-alpha-L-Ara4N flippase - ArnE subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-276
Predicted SEED Role
"Polymyxin resistance protein PmrL, sucrose-6 phosphate hydrolase" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385Y729 at UniProt or InterPro
Protein Sequence (113 amino acids)
>DZA65_RS22635 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (Dickeya dianthicola ME23) MTNYLLILLVSLLTCAGQLSQKQAASWQSGGRSHRAHILLWMGISLLLLGVAMVLWLAVL QRVAVSVAYPMLSLNFILVALAARWLWREAISLRQSVGIVLIVVGVILMGGNA