Protein Info for DZA65_RS22370 in Dickeya dianthicola ME23

Annotation: F0F1 ATP synthase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details PF03899: ATP-synt_I" amino acids 17 to 109 (93 residues), 65.3 bits, see alignment E=2.9e-22

Best Hits

KEGG orthology group: K02116, ATP synthase protein I (inferred from 96% identity to ddd:Dda3937_00152)

Predicted SEED Role

"ATP synthase protein I" in subsystem F0F1-type ATP synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CY83 at UniProt or InterPro

Protein Sequence (127 amino acids)

>DZA65_RS22370 F0F1 ATP synthase subunit I (Dickeya dianthicola ME23)
MSVSLYSGKIARLSLSLQLTVIFVVSAAFYVGGTKAGASALAGGLAAWLPNMVFILFAVR
HQTDKPPEGRVAWSFVVGEALKMLFTIVLLVVALGVFHAAFFPLGLTYLVVLITQIVAPA
VINRYRS