Protein Info for DZA65_RS22320 in Dickeya dianthicola ME23

Annotation: YgiW/YdeI family stress tolerance OB fold protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00156: TIGR00156 family protein" amino acids 2 to 133 (132 residues), 134.4 bits, see alignment E=1.2e-43 PF04076: BOF" amino acids 31 to 132 (102 residues), 116.6 bits, see alignment E=2.5e-38

Best Hits

Swiss-Prot: 48% identical to YGIW_ECO57: Protein YgiW (ygiW) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 80% identity to dze:Dd1591_4176)

Predicted SEED Role

"Protein ygiW precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CSP5 at UniProt or InterPro

Protein Sequence (135 amino acids)

>DZA65_RS22320 YgiW/YdeI family stress tolerance OB fold protein (Dickeya dianthicola ME23)
MKKRIVLVVAAALCSASLYAAQTGGFLGPGESAPAPSSSATGGFSGPDASLTTVAQVNDM
RDDSWVRLQGNIIQRVGKEDYQFRDATGTLLVEIDDRRWEGQTITPEDRVELKGELDKGF
SSIQLDVKQIRKIQK