Protein Info for DZA65_RS22210 in Dickeya dianthicola ME23

Annotation: nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 TIGR01818: nitrogen regulation protein NR(I)" amino acids 6 to 467 (462 residues), 807.3 bits, see alignment E=2.1e-247 PF00072: Response_reg" amino acids 6 to 115 (110 residues), 113.4 bits, see alignment E=1.8e-36 PF00158: Sigma54_activat" amino acids 141 to 307 (167 residues), 239.6 bits, see alignment E=4.6e-75 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 77.8 bits, see alignment E=3e-25 PF07724: AAA_2" amino acids 161 to 278 (118 residues), 27.7 bits, see alignment E=8.1e-10 PF07728: AAA_5" amino acids 165 to 284 (120 residues), 31.2 bits, see alignment E=6.3e-11 PF02954: HTH_8" amino acids 428 to 467 (40 residues), 51.5 bits, see alignment 2e-17

Best Hits

Swiss-Prot: 91% identical to NTRC_KLEPN: DNA-binding transcriptional regulator NtrC (ntrC) from Klebsiella pneumoniae

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 99% identity to dda:Dd703_3962)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CMU8 at UniProt or InterPro

Protein Sequence (470 amino acids)

>DZA65_RS22210 nitrogen regulation protein NR(I) (Dickeya dianthicola ME23)
MQRGIVWIVDDDSSIRWVLERALTGAGLTCATFDNGTQALNALTTQTPDVLLSDIRMPGM
DGLALLQQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAIS
HYMEQQQPARSQPISGPTTDIIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVAH
ALHRHSPRTKAPFIALNMAAIPKDLIESELFGHEKGAFTGANQIRQGRFEQADGGTLFLD
EIGDMPLDVQTRLLRVLADGQFYRVGGYAAVKVDVRIIAATHQNLELRVQEGKFREDLFH
RLNVIRVHLPPLRERREDIPRLARYFLQATARELGVEPKNLHPETEAALTRLPWPGNVRQ
LENTCRWLTVMAAGQEVLIQDLPPELFETTAPDATVHVMPDSWATLLAQWADRALRSGHQ
NLLAEAQPEMERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLKELGME