Protein Info for DZA65_RS22085 in Dickeya dianthicola ME23

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 112 to 286 (175 residues), 60.1 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 94% identity to ddd:Dda3937_01140)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3B3 at UniProt or InterPro

Protein Sequence (297 amino acids)

>DZA65_RS22085 carbohydrate ABC transporter permease (Dickeya dianthicola ME23)
MGMASSLIALAEPVVSAAARRPVFRGREVLKHLLLMVSGLLMVFPFVWMLSGALKTNDEI
FRHPLQLLPSHPDFSSFATVWRETHFGLFMYNSLTVALLTSLLVVVNSVLFAYAIVQWRG
KAGRLLYGVVMACYMLPGAVTYIPCYIILAKLHVLDTHIGLIFSNAVSAMGVFYLHQALK
KIHPSLMEAARIDGAGEWALLRTIVLPQIKPVLATLFLLIFITHYNSYMWPSLVITSPSL
NLISIGIRQYFISGGDYGFNWSNIMAASAIVVMPMLFLFLLCQRMILSGFSDNGVKE