Protein Info for DZA65_RS22040 in Dickeya dianthicola ME23

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 179 to 203 (25 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 160 to 338 (179 residues), 42.9 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 97% identity to dze:Dd1591_4124)

Predicted SEED Role

"ABC transporter, membrane spanning protein [sugars]"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3K4 at UniProt or InterPro

Protein Sequence (348 amino acids)

>DZA65_RS22040 carbohydrate ABC transporter permease (Dickeya dianthicola ME23)
MTTMTTVDWARQAACSRWNRVGFLASVVLFLTLVSIPIVTPYLWLLAISFTQRDGGSEYQ
VLWRLLTIAALAYGVLLAVAWRARTEQRARRLRWLVGLAALLVFGLWVAPQLTWHNYRFL
WNPDVQATGIQSGTLPSVWTALGNSLLFAAGHTLLVTLLAVPAAYALSRLGFRRREGVLK
ALLLLHAFPVMALTVALFIQLYWMGLLNSLWGVMLVMCTLELPFAIFVMKNFFDGVSWDI
EMSAITDGASRFQAFRLVVLPQVTGGIIAIAIFAFLRGWEEYIFVRTLLIDSGRMTMSLY
LFWASQDSMGADSGLIAAVGVIYILPVLALYLLTQQYLTQMSVGGIKG