Protein Info for DZA65_RS22005 in Dickeya dianthicola ME23

Annotation: inorganic phosphate transporter PitA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 378 to 402 (25 residues), see Phobius details amino acids 476 to 498 (23 residues), see Phobius details PF01384: PHO4" amino acids 30 to 491 (462 residues), 307.5 bits, see alignment E=5.6e-96

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 97% identity to ddd:Dda3937_01159)

Predicted SEED Role

"Low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D1I3 at UniProt or InterPro

Protein Sequence (502 amino acids)

>DZA65_RS22005 inorganic phosphate transporter PitA (Dickeya dianthicola ME23)
MLHLFAGLDFHTGLMLVLALLFVLFYEAINGFHDTANAVATVIYTRAMRAQLAVVMAGVF
NFLGVLLGGLSVAYAIVHLLPTDLLLNVSSAHGLAMVFSMLLAAIIWNLGTWYFGLPASS
SHTLIGAIIGIGLTNALVTHTSVVDALNIPKMVSIFLSLLVSPVVGMIIAGLMVYLLRRY
WSNNKKRQRVHLTPAEREKQDGKRKPPFWTRTALILSAVGVSFSHGANDGQKGIGLIMLV
LIGVAPAGFMLNMNASGYDISRTRDAVVNLQTYYQSHSAALTHVIDLSHPVIPAPENVIP
STGNKPDFHCDMSRALIAIDRAQGLLNNVKSYDELAADDRARARRLLMCISDTLDRVVKL
PETSSDDKRLLNNLRSDLLYTVEYAPLWIIVAVALALSLGTMVGWKRVAVTIGEKIGKKG
MTYAQGVSAQVTAAMSIGIASYTGMPVSTTHVLSSAVAGTMIVDGGGVQSKTVKSILLAW
VFTLPVSMLLSGVLYWLALKLI