Protein Info for DZA65_RS21990 in Dickeya dianthicola ME23

Annotation: sugar-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF05116: S6PP" amino acids 4 to 75 (72 residues), 20.9 bits, see alignment E=4.9e-08 amino acids 178 to 244 (67 residues), 36.5 bits, see alignment E=8.6e-13 TIGR00099: Cof-like hydrolase" amino acids 5 to 264 (260 residues), 224.5 bits, see alignment E=1.7e-70 TIGR01484: HAD hydrolase, family IIB" amino acids 5 to 237 (233 residues), 101.6 bits, see alignment E=6.8e-33 PF08282: Hydrolase_3" amino acids 6 to 264 (259 residues), 223.7 bits, see alignment E=6.9e-70

Best Hits

Swiss-Prot: 66% identical to YIDA_ECOLI: Sugar phosphatase YidA (yidA) from Escherichia coli (strain K12)

KEGG orthology group: K07024, (no description) (inferred from 95% identity to dze:Dd1591_4113)

MetaCyc: 66% identical to sugar phosphatase YidA (Escherichia coli K-12 substr. MG1655)
Sugar-phosphatase. [EC: 3.1.3.23]

Predicted SEED Role

"Promiscuous sugar phosphatase YidA, haloacid dehalogenase-like phosphatase family"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D8F2 at UniProt or InterPro

Protein Sequence (271 amino acids)

>DZA65_RS21990 sugar-phosphatase (Dickeya dianthicola ME23)
MAIKLIAIDMDGTLLTPENQISPAVKQAITAAREKGVYVALATGRPFIGVERYLEQLGLQ
QDGHYCITNNGALVQRTATGECVAQTTLSFEDYLHFEALSRELGVHFHALDFNYVYTANK
DISAYTVHESHLTSMPLKYRAVEEMDPGLRFPKLMMIDEPDVLDAAIARIPREDFTHYTI
MKSAAFYLEILDKRVNKGEGVKMLAQHLGLEPDEVMALGDQENDLAMIEFAGLGVAMGNA
IDSVKAVSQFVTRSNSEDGVAYAIEKFVLNV