Protein Info for DZA65_RS21815 in Dickeya dianthicola ME23

Annotation: inner membrane protein YhjD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 61 to 86 (26 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 285 to 310 (26 residues), see Phobius details TIGR00766: inner membrane protein YhjD" amino acids 42 to 316 (275 residues), 435.4 bits, see alignment E=3.5e-135 PF03631: Virul_fac_BrkB" amino acids 55 to 313 (259 residues), 142 bits, see alignment E=1.4e-45

Best Hits

Swiss-Prot: 96% identical to Y2003_DICD3: Uncharacterized protein Dda3937_02003 (Dda3937_02003) from Dickeya dadantii (strain 3937)

KEGG orthology group: K07058, membrane protein (inferred from 96% identity to ddd:Dda3937_02003)

Predicted SEED Role

"Inner membrane protein YhjD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CWB9 at UniProt or InterPro

Protein Sequence (328 amino acids)

>DZA65_RS21815 inner membrane protein YhjD (Dickeya dianthicola ME23)
MPVKPNPPRPSTEQDTPSGASRQRFGQLTGWLHRIRSVPVVAHFIRAGDRFNDRMGNQFG
AAITYFSFLSLIPILMVSFATAGFVLASNPDLLTGLINRIVNSISDPSLARTLKNTVNTA
VRQRTTVGLTGLLIALYSGVNWIGNLREAIHAQSRDVWERQPHEEEKIYLRYLWDFLSLI
GLLLALVITLFLTSVAGSAQAMIVRALGLGGIDWLRPVMTLIALSISIFANYLLFLWILW
VLPRHNPRRGPLLRGTLMAAIGFEALKFAMTAALPQLATSPSGAAFGSVIGLMTFFYFFA
RLTLFCAAWIATADPKTDTNTQVPLPGA