Protein Info for DZA65_RS21740 in Dickeya dianthicola ME23

Annotation: branched-chain amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13433: Peripla_BP_5" amino acids 27 to 364 (338 residues), 69.2 bits, see alignment E=5.7e-23 PF13458: Peripla_BP_6" amino acids 27 to 349 (323 residues), 190.9 bits, see alignment E=7.7e-60 PF01094: ANF_receptor" amino acids 50 to 361 (312 residues), 88.4 bits, see alignment E=7.5e-29

Best Hits

Swiss-Prot: 78% identical to LIVJ_ECOL6: Leu/Ile/Val-binding protein (livJ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 98% identity to ddd:Dda3937_02017)

MetaCyc: 78% identical to branched chain amino acid/phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D1L6 at UniProt or InterPro

Protein Sequence (370 amino acids)

>DZA65_RS21740 branched-chain amino acid ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MKLSKGNALLVGCLAAAMSHAANAADIKVAIVGAMSGPVAQYGDMEFTGARQAIADINAK
GGVNGNKLVGVEYDDACDPKQAVAVANKVINEGIHYVIGHLCSSSTQPASDIYEDEGVIM
ITPAATAPDLTTRGYKLVMRTTGLDSDQGPTAAKYILEHVKPQRIAVVHDKQQYGEGLAR
AVQDSLKKAKANVVLFEGVTAGDKDFSTLVARLKKENVDFVYFGGYYPEMGQILRQARAA
GITTKFMGPEGVGNSSLSNIAGAASEGMLVTLPKRYDQVPTNQPIVDALKAKKLDSTGPF
VWTTYAALQSLTTAMQRTGSTEPAKLAADLKAKSVDTVMGPLNWDEKGDLKGFEFGVFEW
HADGTSSPVK