Protein Info for DZA65_RS21585 in Dickeya dianthicola ME23

Annotation: Pr2TM family membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 transmembrane" amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details PF13560: HTH_31" amino acids 4 to 54 (51 residues), 34.3 bits, see alignment E=4.8e-12 PF01381: HTH_3" amino acids 4 to 55 (52 residues), 51.3 bits, see alignment E=1.9e-17 PF13443: HTH_26" amino acids 10 to 58 (49 residues), 28.6 bits, see alignment E=2.8e-10 PF13239: 2TM" amino acids 76 to 153 (78 residues), 60.7 bits, see alignment E=2.4e-20

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_03865)

Predicted SEED Role

"FIG00613947: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DAD2 at UniProt or InterPro

Protein Sequence (156 amino acids)

>DZA65_RS21585 Pr2TM family membrane protein (Dickeya dianthicola ME23)
MNTIKSQRLARAWSQEQLAELSALSVRTIQRIENGERASLETLSAIAAAFGVNVTALMEE
DSEQAVSGESLAQRIEQARTQVGQESRFWRSLLLFVPVNALLFAINSLVNPQTRWFLWPL
LIWGGVLAVRAARVFWLRDRWSRWEQERLQKILRKP