Protein Info for DZA65_RS21565 in Dickeya dianthicola ME23

Annotation: agmatine deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03380: agmatine deiminase
  • amino acids 5 to 362 (358 residues), 558.9 bits, E=2.2e-172
• PF04371: PAD_porph
  • amino acids 14 to 361 (348 residues), 404.2 bits, E=2.1e-125

Best Hits

Swiss-Prot: 82% identical to AGUA_PECAS: Putative agmatine deiminase (aguA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K10536, agmatine deiminase [EC: 3.5.3.12] (inferred from 97% identity to ddd:Dda3937_03869)

Predicted SEED Role

"Agmatine deiminase (EC 3.5.3.12)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.12)

MetaCyc Pathways

• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (3/3 steps found)
• putrescine biosynthesis II (3/3 steps found)
• superpathway of polyamine biosynthesis II (6/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.12

Sequence Analysis Tools

See A0A3A4CW85 at UniProt or InterPro

Protein Sequence (365 amino acids)

>DZA65_RS21565 agmatine deiminase (Dickeya dianthicola ME23)
MSELTTPLQDGFSMPAEWAPHDAVWMLWPYRRDNWRLQGDAIPAQRTFAAVAAAIAQTTP
VIMGVPRDQMALAKSVMPAGVTLVEMESDDAWMRDTGPTVVLNDAGERRGVDWQFNAWGG
ALGGLYEDWRRDENVAAQVLAYHGDARYAAPLILEGGSIHTDGEGTLLTTAECLLNRNRN
PYLNKAQIEQLLRDYLGVTAFIWLEEGVYNDETDGHIDNMCCFVRPGEVALHWTDDETDP
QYARSQAAYQVLSQAKDAKGRALKIWKLPVPGPLYATPEEAAGVTDGNAVERNAGSRLAG
SYVNFLISNQQIIYPLLDERTDAKAHALLQQMFPNYLISGVPAREILLGGGNIHCITQQI
PAKSV