Protein Info for DZA65_RS21500 in Dickeya dianthicola ME23

Annotation: ATP-dependent protease subunit HslV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 TIGR03692: ATP-dependent protease HslVU, peptidase subunit" amino acids 2 to 172 (171 residues), 284.8 bits, see alignment E=1e-89 PF00227: Proteasome" amino acids 2 to 169 (168 residues), 84.4 bits, see alignment E=4.3e-28

Best Hits

Swiss-Prot: 97% identical to HSLV_PECAS: ATP-dependent protease subunit HslV (hslV) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 92% identity to ecc:c4885)

MetaCyc: 92% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D949 at UniProt or InterPro

Protein Sequence (176 amino acids)

>DZA65_RS21500 ATP-dependent protease subunit HslV (Dickeya dianthicola ME23)
MTTIVSVRRNGQVVIGGDGQATLGNTVMKGNVRKVRRLYNDRVIAGFAGGTADAFTLFEL
FERKLELHQGHLVKAAVELAKDWRTDRMLRRLEALLAVADENASLIITGNGDVIQPENDL
IAIGSGGPYAQAAARALLENSELSAREIVEKSLGIAGDICIYTNQFHTIEELASKA