Protein Info for DZA65_RS21265 in Dickeya dianthicola ME23

Annotation: thioredoxin TrxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 PF00085: Thioredoxin" amino acids 5 to 105 (101 residues), 116.4 bits, see alignment E=8.2e-38 TIGR01068: thioredoxin" amino acids 9 to 107 (99 residues), 129.6 bits, see alignment E=2.1e-42 PF13098: Thioredoxin_2" amino acids 19 to 104 (86 residues), 32.8 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 88% identical to THIO_SALTY: Thioredoxin 1 (trxA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03671, thioredoxin 1 (inferred from 96% identity to dze:Dd1591_0156)

MetaCyc: 88% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CFZ7 at UniProt or InterPro

Protein Sequence (108 amino acids)

>DZA65_RS21265 thioredoxin TrxA (Dickeya dianthicola ME23)
MSDKIIHLTDDSFETDVLQSEHVTLVDFWADWCGPCKMIAPILDEIADEFDGKLTVAKLN
IDDNPATAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLNANL