Protein Info for DZA65_RS21235 in Dickeya dianthicola ME23

Annotation: dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR02382: TDP-D-fucosamine acetyltransferase" amino acids 45 to 234 (190 residues), 261.2 bits, see alignment E=2.5e-82 PF13302: Acetyltransf_3" amino acids 89 to 224 (136 residues), 28.5 bits, see alignment E=2.3e-10 PF00583: Acetyltransf_1" amino acids 153 to 222 (70 residues), 41.3 bits, see alignment E=1.7e-14

Best Hits

Swiss-Prot: 47% identical to WECD_ECOLI: dTDP-fucosamine acetyltransferase (wecD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to dze:Dd1591_0162)

MetaCyc: 47% identical to RffC (Escherichia coli K-12 substr. MG1655)
TDPFUCACTRANS-RXN [EC: 2.3.1.210]

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein RffC"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.210

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CSI8 at UniProt or InterPro

Protein Sequence (234 amino acids)

>DZA65_RS21235 dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase (Dickeya dianthicola ME23)
MPVCAEIEPLVWESDFFQRICGRLSFQETAPLLTTADLDRYELCQAKLAASDLATADALS
ALGFRLAEGEVDFSMPVVPVARAMFAVGVREAETGDIPALRVAAEKSFVLSRFRAPWYRP
DDCGRFYARWVEKAVHGSFDDACLVMGGQGLPLQGFVTLRQTSPSTARIGVLSAWPGMTG
QGIGQRLMQVARVWCQQRGIRRLMVATQTSNLAALRLYLRSGARVESTAYWFYR