Protein Info for DZA65_RS21130 in Dickeya dianthicola ME23

Annotation: uroporphyrinogen-III C-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details PF04375: HemX" amino acids 130 to 363 (234 residues), 348.9 bits, see alignment E=7.8e-109

Best Hits

Swiss-Prot: 63% identical to HEMX_ECOLI: Protein HemX (hemX) from Escherichia coli (strain K12)

KEGG orthology group: K02496, uroporphyrin-III C-methyltransferase [EC: 2.1.1.107] (inferred from 96% identity to ddd:Dda3937_00291)

Predicted SEED Role

"Homolog of E. coli HemX protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.107

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C838 at UniProt or InterPro

Protein Sequence (375 amino acids)

>DZA65_RS21130 uroporphyrinogen-III C-methyltransferase (Dickeya dianthicola ME23)
MTEHITSPTPSEEVAERAEPTPPQKSSPASGAPRHGLVLGAIAIVVSLALSGGVYYYAHQ
QMMRQSMAQAQLQDQLAALQKQQSQAQQQWQQTLDQQAKALSADEQRLAALTRQAGEMQE
KLATLANSDSKTWLLAQADFLVKQAGRKLWSDKDVTTAGALLKSADASLADMNDPSLLDV
RRAITHDIGMLAGVSQIDFDGIILKVNQLADQVDNLRLADTDTDEAPMEESDSTLSASLS
EWRQNLSKSWHNFLSDFITIRRRDDSAEPLLAPNQDVYLRENIRSRLLVAAQAVPRHQNE
TYRQSLETAATWIRAYFDESDPTTKAFLEQLDTLSQQSVAMDVPNELQSQPLLDKLMQTR
VRNLLAQPSARPQEG