Protein Info for DZA65_RS21065 in Dickeya dianthicola ME23

Annotation: AbrB family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 235 to 259 (25 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 309 to 312 (4 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details TIGR03082: membrane protein AbrB duplication" amino acids 10 to 163 (154 residues), 137.2 bits, see alignment E=2.1e-44 amino acids 190 to 343 (154 residues), 136.6 bits, see alignment E=3.3e-44 PF05145: AbrB" amino acids 33 to 343 (311 residues), 317.2 bits, see alignment E=5e-99

Best Hits

Swiss-Prot: 54% identical to ABRB_ECOLI: Putative regulator AbrB (abrB) from Escherichia coli (strain K12)

KEGG orthology group: K07120, (no description) (inferred from 91% identity to ddc:Dd586_3866)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y6E1 at UniProt or InterPro

Protein Sequence (352 amino acids)

>DZA65_RS21065 AbrB family transcriptional regulator (Dickeya dianthicola ME23)
MERFPVLTQWFMLLAVSLVLGFGLLVYHVPAALLLGPMLVGVVMGLNGATIRIPRPLFYA
SNAVLGCLVAQSLSLSILMLLVKEWPLVLFILLSTLVASGLSGWLLMRYSELPGTTGTWG
ASPGGASAMVAMAGDFGADVRLVAFMQYLRLLMVTASAAFVARASLGQGAEANNALLVWF
PALDWRFPGTLVMAFSCAWVGRRLRIPSGQLLVPMIVGSILHSSGIMTLQTPEWLLAVAY
ALIGWSVGLAFTRTVFLLALRTLPKMMLSIITLMLLCGGMALMLTHLLSVDMLTAYLATS
PGGLDSIAVIAASSRVDIAFVMAFQTMRLFSTLIFSPILSRYISRHAVVDTA