Protein Info for DZA65_RS20965 in Dickeya dianthicola ME23
Annotation: gluconokinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to IDNK_ECOLI: Thermosensitive gluconokinase (idnK) from Escherichia coli (strain K12)
KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 95% identity to ddd:Dda3937_00323)MetaCyc: 60% identical to D-gluconate kinase, thermosensitive (Escherichia coli K-12 substr. MG1655)
Gluconokinase. [EC: 2.7.1.12]
Predicted SEED Role
"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)
MetaCyc Pathways
- ketogluconate metabolism (7/8 steps found)
- D-gluconate degradation (1/1 steps found)
- L-idonate degradation (2/3 steps found)
- sorbitol biosynthesis II (2/3 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.1.12
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385Y2N0 at UniProt or InterPro
Protein Sequence (172 amino acids)
>DZA65_RS20965 gluconokinase (Dickeya dianthicola ME23) MSGQSIILMGVSGSGKSSVGARLAREINAKFIDGDDLHPRANIQKMASGQPLNDDDRAPW LERLNDAAYSLLHKNETGIIVCSALKKRYRDRLRAGNDGMVFLYLKGNFEVILQRHQARA GHFMPTGLLQSQFDALEEPDQTETDVITVDINGPMDQVAARCAAALREHSSR