Protein Info for DZA65_RS20955 in Dickeya dianthicola ME23

Annotation: YhgN family NAAT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 41 to 63 (23 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details PF01914: MarC" amino acids 2 to 194 (193 residues), 199.4 bits, see alignment E=2.2e-63

Best Hits

Swiss-Prot: 76% identical to YHGN_ECO57: UPF0056 inner membrane protein YhgN (yhgN) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_00325)

Predicted SEED Role

"Multiple antibiotic resistance protein marC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CDN5 at UniProt or InterPro

Protein Sequence (197 amino acids)

>DZA65_RS20955 YhgN family NAAT transporter (Dickeya dianthicola ME23)
MTEMISATILLLLIMDPLGNLPVFMSVLKHLDPKRRRVVLIREMIIALGVMLVFLFAGEK
ILAILNLRTETVSISGGIVLFLIAIRMIFPTQEGFTSGLPAGDEPFLVPLAIPMVAGPSI
LAALMLLSHQYPKQMPHLTLALFIAWGITVVVLLLSNLFLRLLGDKGVNALERLMGLVLV
MLSTQMFLDGIRAYLKL