Protein Info for DZA65_RS20935 in Dickeya dianthicola ME23

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 163 (27 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 29 to 197 (169 residues), 200.7 bits, see alignment E=1.9e-63 PF06580: His_kinase" amino acids 372 to 446 (75 residues), 91.3 bits, see alignment E=5.5e-30 PF02518: HATPase_c" amino acids 470 to 559 (90 residues), 31.1 bits, see alignment E=4e-11

Best Hits

Swiss-Prot: 67% identical to BTSS_SHIFL: Sensor histidine kinase BtsS (btsS) from Shigella flexneri

KEGG orthology group: K02478, two-component system, LytT family, sensor kinase [EC: 2.7.13.3] (inferred from 96% identity to ddd:Dda3937_00329)

MetaCyc: 67% identical to high-affinity pyruvate receptor (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Autolysin sensor kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2P5 at UniProt or InterPro

Protein Sequence (561 amino acids)

>DZA65_RS20935 sensor histidine kinase (Dickeya dianthicola ME23)
MISQIDLILSLLQQTCVYLVIAYLLSKTPLFIPLTQVTIRLPHKLICYLTFSMFCILGTY
FGLHIDDSIANTRAIGALLGGVLGGPSVGVLVGLTGGLHRYSLGGMTALACMVSTIAEGL
AGGLLHRYMTRRHRIDLLFQPLVIAAVTLLVEVLQMSIILLLSRPFADALALVKSIALPM
LITNSVGAAMFMRILLDRRAMFEKYTSAFSARALQIAARAEGALREGFNSRTSMRVARIL
YEELGVGAVAITDREKLLAFIGIGDDHHTAGSLITSPLTHQAIDHNQVVYADGNETLFNC
SISPHCKLGSTLVIPLRGEEQRVIGTIKLYEPKNKLFSSINRTLGEGIGHLLSAQIFAGR
FEQQKQLLAQSEIKLLHAQVNPHFLFNTLNTLSSIIRRNPDQARQLVLSLSTFFRKNLKR
SSDEVSLSDELEHINAYLEIEKARFVNLLTVEIVIPPSLRAARLPAFSLQPLVENAIKHG
ISHMLDNGHLRIDARTHANMLELTVEDNAGIYHPRNGGDGLGMNLVDRRIKARYGHHYGI
TVASEPERFTRVRVRVPLQVG