Protein Info for DZA65_RS20895 in Dickeya dianthicola ME23

Annotation: rhomboid family intramembrane serine protease GlpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 96 to 115 (20 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details PF12122: Rhomboid_N" amino acids 1 to 83 (83 residues), 98.8 bits, see alignment E=1.7e-32 TIGR04239: rhomboid family protease GlpG" amino acids 3 to 270 (268 residues), 378.7 bits, see alignment E=9.9e-118 PF01694: Rhomboid" amino acids 134 to 268 (135 residues), 107.2 bits, see alignment E=8.6e-35

Best Hits

Swiss-Prot: 69% identical to GLPG_PECAS: Rhomboid protease GlpG (glpG) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02441, GlpG protein (inferred from 94% identity to ddd:Dda3937_00344)

MetaCyc: 56% identical to rhomboid protease GlpG (Escherichia coli K-12 substr. MG1655)
Rhomboid protease. [EC: 3.4.21.105]

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.105

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2Y9 at UniProt or InterPro

Protein Sequence (274 amino acids)

>DZA65_RS20895 rhomboid family intramembrane serine protease GlpG (Dickeya dianthicola ME23)
MIRIVALSNPRLAQAFIDYMHTHQVRLVARINGNDVDIWLPDESQQERVKQELARFLQEP
WHERYQAASWQNGTTDSGLRYPSFSYLQTLRQRAGPLTLGVLVVAIAVYLLMQAYGVERM
MALLAFPDSVQTPQLWRWFSHALLHFSLLHLLFNLMWWWYLGGPVERVLGTRRLCVILLL
SSAFSGWVQSWFSGVYFGGLSGVVYALMGYVWLRGEREPDGSLHLQRGLMAFALVWLVVG
YFDILGMSIANAAHIAGLVIGLLMAWWDTRNRRR