Protein Info for DZA65_RS20890 in Dickeya dianthicola ME23

Annotation: DeoR/GlpR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF08279: HTH_11" amino acids 6 to 47 (42 residues), 27.1 bits, see alignment 4.5e-10 PF08220: HTH_DeoR" amino acids 6 to 61 (56 residues), 86.6 bits, see alignment E=1.1e-28 PF00455: DeoRC" amino acids 76 to 232 (157 residues), 183.8 bits, see alignment E=3.4e-58

Best Hits

Swiss-Prot: 79% identical to GLPR_SHIFL: Glycerol-3-phosphate regulon repressor (glpR) from Shigella flexneri

KEGG orthology group: K02444, DeoR family transcriptional regulator, glycerol-3-phosphate regulon repressor (inferred from 99% identity to ddc:Dd586_3829)

Predicted SEED Role

"Glycerol-3-phosphate regulon repressor, DeoR family" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2K1 at UniProt or InterPro

Protein Sequence (252 amino acids)

>DZA65_RS20890 DeoR/GlpR family transcriptional regulator (Dickeya dianthicola ME23)
MKQTQRHDAIIDLVRRQGYVSTEELVEHFAVSPQTIRRDLNDLAEQNKIHRHHGGAALPS
SSVNTAYHDRKMMWSDEKARIARQVASQIPDGATLFIDIGTTPEAVAHALMNHKDLRVVT
NNLNVATLLTAKEDFRLILAGGEVRSRDGGIIGEATLDFISQFRLDFGILGISGIDMDGS
LLEFDYHEVRTKRAIIENSRCVMLVTDHSKFGRNAMVNLGNMDLIDYLFTDQLPPSSVLK
IIEQHKVQLELC