Protein Info for DZA65_RS20845 in Dickeya dianthicola ME23

Annotation: transcription elongation factor GreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 TIGR01461: transcription elongation factor GreB" amino acids 2 to 155 (154 residues), 248.8 bits, see alignment E=8.8e-79 PF03449: GreA_GreB_N" amino acids 5 to 74 (70 residues), 85.4 bits, see alignment E=2.7e-28 PF01272: GreA_GreB" amino acids 81 to 155 (75 residues), 77.4 bits, see alignment E=6.8e-26

Best Hits

Swiss-Prot: 74% identical to GREB_SALTI: Transcription elongation factor GreB (greB) from Salmonella typhi

KEGG orthology group: K04760, transcription elongation factor GreB (inferred from 97% identity to ddd:Dda3937_00353)

Predicted SEED Role

"Transcription elongation factor GreB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2X9 at UniProt or InterPro

Protein Sequence (172 amino acids)

>DZA65_RS20845 transcription elongation factor GreB (Dickeya dianthicola ME23)
MKTDLITREGYEALHQELNYLWKERRPEITEKVAWAASLGDRSENADYLYNKRLLREIDR
RVRYLRKRLQVVRVVDYSPQQDGKVFFGAWVEVENEEGDVKHFRIVGPDEIYGRKDYISI
DAPMARALLKKAVDEDAVVNTPTGPKVWYINKIDYRNPIGDRNPIDSRNPID