Protein Info for DZA65_RS20815 in Dickeya dianthicola ME23

Annotation: ribosome-associated heat shock protein Hsp15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF01479: S4" amino acids 13 to 59 (47 residues), 49.8 bits, see alignment E=1.1e-17

Best Hits

Swiss-Prot: 76% identical to HSLR_ECOLI: Heat shock protein 15 (hslR) from Escherichia coli (strain K12)

KEGG orthology group: K04762, ribosome-associated heat shock protein Hsp15 (inferred from 95% identity to ddd:Dda3937_00359)

Predicted SEED Role

"Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog)" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CF53 at UniProt or InterPro

Protein Sequence (137 amino acids)

>DZA65_RS20815 ribosome-associated heat shock protein Hsp15 (Dickeya dianthicola ME23)
MSKGSQHDDDNAVRLDKWLWAARFYKTRSLAREMIDGGKVHYNGQRSKPGKLVELDAEIT
LRQGNDARTVIVRTLSVQRRPAAQAQALYEETQQSIEKREQLAQARKLNTLSMPHPDRRP
DKKERRDLIKFKYSDAE