Protein Info for DZA65_RS20705 in Dickeya dianthicola ME23

Annotation: polysaccharide lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00544: Pectate_lyase_4" amino acids 72 to 279 (208 residues), 315.2 bits, see alignment E=2.1e-98

Best Hits

Swiss-Prot: 93% identical to PLYC_DICCH: Pectate lyase C (pelC) from Dickeya chrysanthemi

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_04193)

MetaCyc: 84% identical to pectate lyase C (Dickeya dadantii 3937)
Pectate lyase. [EC: 4.2.2.2]

Predicted SEED Role

"Pectate lyase B precursor (EC 4.2.2.2)" (EC 4.2.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.2.2

Use Curated BLAST to search for 4.2.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2H9 at UniProt or InterPro

Protein Sequence (375 amino acids)

>DZA65_RS20705 polysaccharide lyase (Dickeya dianthicola ME23)
MKSLITPITAGLLLALSQPLLAATDTGGYAVTGGGNVAGTVSKTATSMQDIVNIIAAARL
DASGKKVTGGAYPLVITYTGNEDSLINAAAANICGQWSKDARGVEIKEFTKGITIIGANG
SSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMVRVDDSPNVWVDHNELFAANHECDGT
PDGDTTFESAVDIKGASDYVTVSYNYIHGVKKVGLDGSSSSDTGRNITYHHNRYNDVNAR
LPLQRGGLVHAYNNLYSNVTSSGLNVRQNGQALIENNWFENAVNPVTSRYDGKNFGTWVL
KNNNITKPADFSTYSITWTADTKAYVNADSWTSTGTFPTVAYSYSPVSAQCVKDQLANYA
GVGKNLATLASTTCK