Protein Info for DZA65_RS20690 in Dickeya dianthicola ME23

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 80% identity to dze:Dd1591_0274)

Predicted SEED Role

"FIG00613665: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CEP1 at UniProt or InterPro

Protein Sequence (429 amino acids)

>DZA65_RS20690 hypothetical protein (Dickeya dianthicola ME23)
MSASPSRMALAEALFASLIFIGLLGFSTYMVYHKSLSTLEQEIKIGLLSNVRAAASTLSG
DRHQDITARTVRDDPVYQQLAVQLERIRQASQDVRYIYTTVLDQDKVRFVVNPSPQNDND
GDGLPDLPPALMQVYDNAPAELVDALRQHKTAVSGQPYRDEWGFFISAYAPFYDQQGEFR
GVLAMDLELSSFYQRLEALNQVFRKAISTILFLGLVVGLAVWWMRRSSQQVRVQLASREQ
AYSALLHATSPSHLERLYDWPLPLLFLRGGDHHRPPAYPAATAAEPSPPESAQEQQASLS
EWWRNAAPSLLPCPDSVLAMAPTAALEAHFSPDCCRRFWQQSFQLWRQLAQQPLTIEVNQ
REEALLHWVLDIRLTRCGEPDAAVAEDLDWWQRFLRWQAEAEPAQVTIRQVTRGQLLLSW
RVPKYPEAL