Protein Info for DZA65_RS20630 in Dickeya dianthicola ME23

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 42 to 68 (27 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details PF01810: LysE" amino acids 17 to 191 (175 residues), 55 bits, see alignment E=3.9e-19

Best Hits

Swiss-Prot: 30% identical to EAMB_SALCH: Cysteine/O-acetylserine efflux protein (eamB) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_00541)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C734 at UniProt or InterPro

Protein Sequence (201 amino acids)

>DZA65_RS20630 LysE family translocator (Dickeya dianthicola ME23)
MEHFSLFLSMLGFLWVAAITPGPNNMLLTASAANFGVLRSMPLMLGIMVGMQSMLLLVAL
GLGSLILLYPSLHLALKVLGSIYLLWLSWKIATAAYEQLDTDTAPPAPIPLYQGGLLQFL
NPKAWLMALGAVAGFSLAGDGYAGSVMAISVAMVCVNFVAGVIWLGFGAMIGRLLQSPRA
WKVFNLVMGLLTATCVLMIWH