Protein Info for DZA65_RS20615 in Dickeya dianthicola ME23

Annotation: glutathione-regulated potassium-efflux system protein KefB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 14 to 283 (270 residues), 300.4 bits, see alignment E=6.9e-94 PF00999: Na_H_Exchanger" amino acids 16 to 373 (358 residues), 218.2 bits, see alignment E=2.5e-68 PF02254: TrkA_N" amino acids 403 to 514 (112 residues), 88.2 bits, see alignment E=7.7e-29 PF27452: KefB_C" amino acids 522 to 593 (72 residues), 85.9 bits, see alignment E=2.7e-28

Best Hits

Swiss-Prot: 85% identical to KEFB_PECAS: Glutathione-regulated potassium-efflux system protein KefB (kefB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K11747, glutathione-regulated potassium-efflux system protein KefB (inferred from 97% identity to ddd:Dda3937_00538)

MetaCyc: 79% identical to K+ : H+ antiporter KefB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-42

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C4Q9 at UniProt or InterPro

Protein Sequence (601 amino acids)

>DZA65_RS20615 glutathione-regulated potassium-efflux system protein KefB (Dickeya dianthicola ME23)
MEASSLLNAGVLFLFVAVLMVPIAARLGIGAVLGYLLAGIAIGPWGLGFIRDVEAILHFS
ELGVVFLMFIIGLELDPAKLWRLRRSIFGTGAAQVLLSAAVLGGSLYLSRFSWQAALIGG
IGLAMSSTAIALQLMREKGMNRNESGQLGFSVLLFQDLAVIPALALIPVLAGAQGELDDW
RQVMLKVMAFGGMLIGGRYLVRPLFRFIAASGVREVFTAAALLLVLGSALFMDALGLSMA
LGTFIAGVLLAESEYRHELEIAIEPFKGLLLGLFFISVGMSLNLGVLYANILMVLAGVAM
LVVAKGFILYLLARLYGLRSSERLQFAGVLSQGGEFAFVLFSAAATHKVLKGAQLPLLLV
TVTLSMMVTPLLMQLIDRILVRRFNAKEEPDETPYVENDEPQVIVVGFGRFGQVIARLLM
ANKMRITVLERDISAVSLMRSYGYKVYYGDATELELLRAAGAAQAQSIVITCNEPEDAML
IVHLCQQHFPHLEILARARGRVEAHEFLQLGVTQFSRETFSSALELGRKTLISLGMHPHQ
AYRAQQHFRRLDMRMLRELMPQRKGDVAQISRVKEARRELEDIFAREMLRERRRPDDWDE
H