Protein Info for DZA65_RS20575 in Dickeya dianthicola ME23

Annotation: two-component system sensor histidine kinase PmrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details PF00512: HisKA" amino acids 150 to 207 (58 residues), 39.5 bits, see alignment E=4.8e-14 PF02518: HATPase_c" amino acids 256 to 362 (107 residues), 68.9 bits, see alignment E=5.1e-23

Best Hits

Swiss-Prot: 63% identical to PMRB_PECPM: Sensor histidine kinase PmrB (pmrB) from Pectobacterium parmentieri

KEGG orthology group: K07643, two-component system, OmpR family, sensor histidine kinase BasS [EC: 2.7.13.3] (inferred from 84% identity to ddc:Dd586_3750)

Predicted SEED Role

"Sensor protein basS/pmrB (EC 2.7.3.-)" in subsystem Lipid A modifications or Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y4G9 at UniProt or InterPro

Protein Sequence (376 amino acids)

>DZA65_RS20575 two-component system sensor histidine kinase PmrB (Dickeya dianthicola ME23)
MRLFPRPSPLERTASIRTRLILTLGCILLACQLLSVIWLWHESEEQIQLLVEQTLTEKNL
NQDIALEVNEAIASLSIPSLVMVVASLLMCAHAVNWITRPLMILQDELHNRTAENLDPLQ
QRSDVTEVAAVIASMNQLFTRFSESLRRDRLFASNVAHELRTPLAGIRLSLELHEQVHHI
DCQPLIKRVDHLTKTIEQLLLLARVGNELAAGHYESVSLIDDVITPKQEELEEMAAIRHQ
QLDWQSDTQDGTVLGNVTLLQLLLRNLVENAYRYGPEHSTITVRVTPHACGGCELIVADE
GPGINESQVGELTRAFVRLDTRYGGIGLGLSIVTRIVQLHHGEFFLENRRDRTGTQARVV
FKHHSDGIICYDDDAT